vncolella2006 vncolella2006

13-11-2020
Mathematics

contestada

cnklsnvsklfhnicspkaghnfpwstfryhdesuwiaqogtfyhdsujaiqo1234567890-=QWERTYUIOP[ASDFGHJKL;'ZXCVBNM,./
spain without the s

Respuesta :

BrainlyMastery BrainlyMastery

13-11-2020

Answer:

Bruh Lol

Step-by-step explanation:

Answer Link

beasyholli2 beasyholli2

13-11-2020

Answer:

spain without the s is pain!

Step-by-step explanation:

Answer Link

Otras preguntas

Find the area of a triangle with a base of 10mm and a height of 8mm

What is 2.7 repeating as a fraction?

If the width of a rectangular piece of wood is x + 2 inches long and the length is three times as long with an additional inch added, what is the area of the wo

What is the sequence of 100,99,97,94,90

what is the answer for 0.008 is 1/10 of

Find the LCM of each pair of numbers: 8 and 56 12 and 30

What is the expanded form for 70.26

What was the effect of increased farming and trade ?

Find the approximate side length of each square to nearest whole unite A helicopter launching pad with a area of 3000 ft squared

1 divided by 5 plus two divided by 4